Protein Info for ABIE53_006126 in Paraburkholderia graminis OAS925

Annotation: choline-sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03417: choline-sulfatase" amino acids 5 to 508 (504 residues), 864.4 bits, see alignment E=1.5e-264 PF00884: Sulfatase" amino acids 6 to 350 (345 residues), 180.2 bits, see alignment E=1.2e-56 PF01663: Phosphodiest" amino acids 9 to 297 (289 residues), 43.2 bits, see alignment E=8.2e-15 PF16347: SGSH_C" amino acids 301 to 445 (145 residues), 50.5 bits, see alignment E=5.8e-17 PF12411: Choline_sulf_C" amino acids 455 to 507 (53 residues), 86.9 bits, see alignment 1.2e-28

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_5849)

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.6

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>ABIE53_006126 choline-sulfatase (Paraburkholderia graminis OAS925)
MLDSKKNILILMADQMTPFALSAYGHPLTRTPNLDRLAKQGVVFDSAYCASPLCAPSRFS
FLSGKLPSAIGAYDNAAEFPSQTLTFAHYLRAEGYRTILSGKMHFCGADQLHGFEERLTT
DIYPADFGWTPNWDDFEARPTWYHNMSSVIDAGPCVRTNQLDFDDEVTFTTRQKLFDIAR
ERHAGKDARPFCMVASLTHPHDPYAIPQKYWDMYQDEEIDMPTHRDSFDEADPHSKRLRH
VCETDRTPPTGQQIRNARRAYYGAISYVDDQFGAILEALEEAGLANDTIIVVTSDHGEML
GERGLWYKMTFFEGGCRVPLVVHAPQQFDAHRVSASVSHLDLLPTLVELARGEPPAAWPD
SLDGHSLMPHLLGERGGHDEAIGEYLAEGAIAPIVMLRRGRFKFIHTPVDPDQLYDVQAD
PLERANLAFNAEYAAQVEAFRKEIAARWNLAALHQEVLQSQRRRRFHFAATTQGTVASWD
WQPLVDASQRYMRNHIDLDTLEAMARFPAVAH