Protein Info for ABIE53_006002 in Paraburkholderia graminis OAS925

Annotation: uracil-DNA glycosylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03914: uracil-DNA glycosylase family domain
  • amino acids 10 to 214 (205 residues), 248.1 bits, E=8.9e-78
• TIGR00758: uracil-DNA glycosylase, family 4
  • amino acids 40 to 201 (162 residues), 127.5 bits, E=4.3e-41
• PF03167: UDG
  • amino acids 54 to 206 (153 residues), 116.6 bits, E=5e-38

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 93% identity to bug:BC1001_3617)

Predicted SEED Role

"Uracil-DNA glycosylase, putative family 6"

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (224 amino acids)

>ABIE53_006002 uracil-DNA glycosylase family protein (Paraburkholderia graminis OAS925)
MVTTKRTPKRTPKRPSSTEGEEPAAPEVDPDQHPATLDDCRRCPLWANATQGVPGAGPRR
APIMMVGEQPGDKEDLQGLPFVGPAGALLDDALVEAGVGRKEVYVTNAVKHFKWTPRGKR
RMHKTPGQREVDACRYWLDQELESVGAHVIVALGATALKAVLEDPKSRLQDSIGKVIEHG
DRLVVATYHPSFALRAPDPETRHRAYAAIVAALQDAKKLAQRRK