Protein Info for ABIE53_005942 in Paraburkholderia graminis OAS925

Annotation: putative murein hydrolase (TIGR00659 family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 216 to 243 (28 residues), see Phobius details PF04172: LrgB" amino acids 25 to 238 (214 residues), 276.3 bits, see alignment E=7.4e-87

Best Hits

Swiss-Prot: 36% identical to YXAC_BACSU: Uncharacterized protein YxaC (yxaC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_3729)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>ABIE53_005942 putative murein hydrolase (TIGR00659 family) (Paraburkholderia graminis OAS925)
MTALPKLGAIWVYLAASPLLGLTITLIAYLIAQTLYAKARFNPLANPVLIAVALLVAVLE
ITGTPYATYFEGAQFVHFLLGPATVALALPLYRQWPKLRRYALPLLGGLVAGSLTAIVSA
IGVAALFGASHQTLASLAPKSATTPIAMAVASEIGGIPSLTAVLVISTGVFGAVFARAIL
NALKIAEPEVRGFALGIASHGIGTARAFQVSEQMGAFAGLGMGLNGVFTAFVVPVLMPVV
ARWLGA