Protein Info for ABIE53_005836 in Paraburkholderia graminis OAS925

Annotation: betaine-aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 34% identical to GEOB_CASDE: Geranial dehydrogenase (geoB) from Castellaniella defragrans

KEGG orthology group: None (inferred from 77% identity to bge:BC1002_5751)

MetaCyc: 34% identical to geranial dehydrogenase (Castellaniella defragrans)
RXN-11970 [EC: 1.2.1.86]; Aldehyde dehydrogenase (NAD(+)). [EC: 1.2.1.86, 1.2.1.3]

Predicted SEED Role

"Aldehyde dehydrogenase A (EC 1.2.1.22)" in subsystem L-rhamnose utilization or Methylglyoxal Metabolism (EC 1.2.1.22)

MetaCyc Pathways

ethanol degradation II (3/3 steps found)
ethanol degradation IV (3/3 steps found)
superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
phytol degradation (3/4 steps found)
ethanol degradation III (2/3 steps found)
hypotaurine degradation (2/3 steps found)
methylglyoxal degradation V (2/3 steps found)
L-lactaldehyde degradation (aerobic) (1/2 steps found)
lactate biosynthesis (archaea) (3/5 steps found)
mitochondrial NADPH production (yeast) (3/5 steps found)
octane oxidation (3/5 steps found)
L-rhamnose degradation II (5/8 steps found)
L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
fatty acid α-oxidation I (plants) (2/4 steps found)
putrescine degradation III (2/4 steps found)
histamine degradation (1/3 steps found)
methylglyoxal degradation IV (1/3 steps found)
3-methyl-branched fatty acid α-oxidation (3/6 steps found)
superpathway of methylglyoxal degradation (4/8 steps found)
β myrcene degradation (1/4 steps found)
serotonin degradation (3/7 steps found)
geraniol and nerol degradation (2/6 steps found)
dopamine degradation (1/5 steps found)
ceramide degradation by α-oxidation (2/7 steps found)
sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
alkane oxidation (1/6 steps found)
superpathway of fucose and rhamnose degradation (5/12 steps found)
aromatic biogenic amine degradation (bacteria) (2/8 steps found)
limonene degradation IV (anaerobic) (1/7 steps found)
noradrenaline and adrenaline degradation (4/13 steps found)
ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.22, 1.2.1.3

Use Curated BLAST to search for 1.2.1.22 or 1.2.1.3 or 1.2.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>ABIE53_005836 betaine-aldehyde dehydrogenase (Paraburkholderia graminis OAS925)
MNWIAGEWAGKPVLASSDPSNGETLGRFVSSNTQDADAAVAAARHTFDHTTWAQDARRRQ
DVLLRWAQALELSVEPLAELLTRENGKTIGQARGEMRAAISEVRYYAGLARHIAGHVIEP
EPGTISTMLREAAGVAAIIVPWNAPAVLLVRPLAPALAAGCTAIVKPAAQTSLITAAMIR
CLDQPALPAGAVNLLLENGAEAAARLVESADVDVISFTGSTEVGKRIMRAAADSMKRLSL
ELGGKSCCLVFEDSDVKAIAPRLARAATIISGQQCTAARRILVHVSKADQMRDELVKALA
SLKVGPGIDPASDIGALIDVASRDAVQTTVERACDLADRVLLRGTSSGPGAFLSPTLVEH
GEPHAFFCQDEIFGPFVTLETFETEKEAVEKANNTVFGLSASVWTHDSARAFRIARALRD
GTVWINDHNRLFAEAETGGYRQSGLGRLHGYDALADFTEIKHICVGAGVVEGIEVLGS