Protein Info for ABIE53_005824 in Paraburkholderia graminis OAS925

Annotation: 4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 149 to 170 (22 residues), see Phobius details PF02627: CMD" amino acids 43 to 105 (63 residues), 23.2 bits, see alignment E=2.7e-09

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 91% identity to bxe:Bxe_B1143)

Predicted SEED Role

"Cation/multidrug efflux pump"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>ABIE53_005824 4-carboxymuconolactone decarboxylase (Paraburkholderia graminis OAS925)
MTERLPAFQLSDATPEQKAVLDEILSGPRGNLNGPFLGWIHSPELAQQAQRLGAFCRYRT
GLPLRLSELAILVTAARWRAQAEWYIHYPIALEAGVREADAEAIRNGLQPDFEDADDALI
YDFASELYDTKRVSDATYARALARFGHEVVINLVGLLGYYALVAMTLNVFDMRANGQQSL
PFAE