Protein Info for ABIE53_005763 in Paraburkholderia graminis OAS925

Annotation: small multidrug resistance family-3 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details PF02694: UPF0060" amino acids 1 to 105 (105 residues), 129.1 bits, see alignment E=4.1e-42

Best Hits

Swiss-Prot: 75% identical to Y1326_ACISJ: UPF0060 membrane protein Ajs_1326 (Ajs_1326) from Acidovorax sp. (strain JS42)

KEGG orthology group: K09771, hypothetical protein (inferred from 72% identity to hse:Hsero_2895)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>ABIE53_005763 small multidrug resistance family-3 protein (Paraburkholderia graminis OAS925)
MKTLLLYIATAMAEIVGCYLPYLWLKEGKSATLLIPAAFSLAMFAWLLTLHPSAAGRVYA
AYGGVYIGVALIWLWAVEGMRPTAWDWTGVSFSLIGMAIIAFQPR