Protein Info for ABIE53_005745 in Paraburkholderia graminis OAS925

Annotation: 8-oxoguanine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF01979: Amidohydro_1" amino acids 57 to 414 (358 residues), 157.2 bits, see alignment E=7.1e-50 PF07969: Amidohydro_3" amino acids 102 to 410 (309 residues), 49.6 bits, see alignment E=4.5e-17

Best Hits

Swiss-Prot: 75% identical to IXPDE_UNKP: Isoxanthopterin deaminase from Unknown prokaryotic organism

KEGG orthology group: None (inferred from 77% identity to bxe:Bxe_A2016)

Predicted SEED Role

"BOX elements"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>ABIE53_005745 8-oxoguanine deaminase (Paraburkholderia graminis OAS925)
MTTTLIRNAAAIMTGGGANEPARAAGPDIRIEGTRIRAVGALAPMPGEAIVDATDCVVYP
AWVNTHHHLFQALLKGDPAGINASLTPWLAATPYRYRARFDEKRFRLAARIGMIELVRSG
CTTIADHNYVYYPDMPFDSSAILFEEAQKLGVRFVLLRGGATRTRQLEAGLPTAMRPESI
DAFMSDLQRLASSFHDASPHSMRRVVAAPTTVLFSVSPAEMRSIAGEARRLGLRLHSHLS
ETVNYQDSAQAMHRLTPVEFCREHGWLGEDVWYAHLVKLDASEIDLLAATGTGIAHCPQS
NGRLGSGIAPVRELADAGVPVSIGVDGAASNEAADMISEVHMAWLAQRARRGMAAQPEYR
GGRFEGGADAASVEEVVHWGTAGGARVLGLEGVGRIEVGAQADIAVYRLDDPRYFGLHDV
AIGPVVSGGRPELAALFCAGQCIVRNDVLPDVDLGALRREAAREVRAMIAEVA