Protein Info for ABIE53_005346 in Paraburkholderia graminis OAS925

Annotation: NNP family nitrate/nitrite transporter-like MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 19 to 43 (25 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 158 to 190 (33 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 300 (276 residues), 124 bits, see alignment E=3.3e-40

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 78% identity to adn:Alide_0506)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ABIE53_005346 NNP family nitrate/nitrite transporter-like MFS transporter (Paraburkholderia graminis OAS925)
MTQTSTATDGPSRRRALSVLIASTLAFTVCFMVWMMFAVVGIPLRRSLHLNETEFGVLAA
LPVLTGSLVRVPLGIWTDRYGGRIVMTALMLATAPAIWLMSYATAYWQLLVIGLFVGLAG
GSFSVGTPYVARWFPPEKRGLAMGVFGAGNSGAAVNKFVAPAIVVAFGWAMVPQVYAVIM
LATAVVFWILSSSDPSHLVSQNVRFVDQLRALKDPTVLKYCQYYSIVFGGYVALSLWMVQ
YYVGEYGLDLRVAALLAACFSLPGGVLRAVGGWLSDRYGAHRVTWWVMWVSWVCLFLLSY
PRTHLIITTVNGAKGFDIGLNVIGFTVLMFVLGIAFAFGKASVFKYIGDEYPDNIGTISG
IVGLAGGLGGFLLPILFGLLVDFTGIRSSAFMLLYGVVWVSLIWMYFTEVRTKDVLAATP
PVSSEQPMRTVGSQPAETES