Protein Info for ABIE53_005329 in Paraburkholderia graminis OAS925

Annotation: 4-oxalmesaconate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to LIGJ_SPHSK: 2-keto-4-carboxy-3-hexenedioate hydratase (ligJ) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K10220, 4-oxalmesaconate hydratase [EC: 4.2.1.83] (inferred from 97% identity to bgf:BC1003_3989)

MetaCyc: 82% identical to subunit of 4-oxalomesaconate hydratase (Pseudomonas straminea)
4-oxalmesaconate hydratase. [EC: 4.2.1.83]

Predicted SEED Role

"4-oxalomesaconate hydratase (EC 4.2.1.83)" (EC 4.2.1.83)

MetaCyc Pathways

gallate degradation I (4/4 steps found)
methylgallate degradation (5/6 steps found)
gallate degradation II (4/5 steps found)
protocatechuate degradation I (meta-cleavage pathway) (6/8 steps found)
superpathway of vanillin and vanillate degradation (6/10 steps found)
syringate degradation (7/12 steps found)

KEGG Metabolic Maps

Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.83

Use Curated BLAST to search for 4.2.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>ABIE53_005329 4-oxalmesaconate hydratase (Paraburkholderia graminis OAS925)
MIIDIHGHYTTAPKALETWRNRQIAALGNPTDAPSPSELQISDDELRESIETNQLRLMRE
RGLDLTVFSPRASFMAHHIGDFNVSSTWAAICNELCYRVSQLFPENFVPAAMLPQSPGVD
VATCIPELVKCVEQYGNVAINLNPDPSGGHWTSPPLSDRYWYPIYEKMVEYDIPAMVHVS
TSCNACFHTTGAHYLNADTTAFMQCLTSDLFRDFPTLRFVIPHGGGAVPYHWGRFRGLAQ
EMKKPLLEEHLLKNIFFDTCVYHQPGIDLLTKVIPVDNILFASEMIGAVRGIDPQTGHYF
DDTKRYVEAAEMNPQQRDKIYEGNARRVYPRLDAALKAQGR