Protein Info for ABIE53_005107 in Paraburkholderia graminis OAS925

Annotation: putative DNA metabolism protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF01391: Collagen" amino acids 64 to 121 (58 residues), 33.6 bits, see alignment 4.1e-12 PF13566: DUF4130" amino acids 170 to 316 (147 residues), 47.6 bits, see alignment E=2.9e-16 PF03167: UDG" amino acids 434 to 543 (110 residues), 92.3 bits, see alignment E=4.8e-30

Best Hits

Predicted SEED Role

"Domain often clustered or fused with uracil-DNA glycosylase / Uracil-DNA glycosylase, putative family 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>ABIE53_005107 putative DNA metabolism protein (Paraburkholderia graminis OAS925)
MNRISIYPSFSAWRDAARLLLRHGVQPERIEWIECPETAQEPASTIGCNGAGAALNQPLA
DASGASGASGASGASGASGASGASGASGASGSSGSSGSSGSSGSSGSSGSSGASGASGAS
GMLQASHASAASHPSHASATPDAANGLAATTAIPRELLAWLKAAACFRAPDRWALLYRVL
WRWTRGERDVLDLGDSDGALLDQRVRAVEHETEDMLNLTLFRRRDPSMGPPEFVGWYEPH
HDLLEYAAERFAARMGYSTWMLATPRGAALWNGMLLHISQPVSEHSVDVPAEDAMTGEAV
TSESTEALWLGYYEEAVSGETPPVPLRYWRAPPEGPPLPAQLGRERICRRGQNAVVTVPA
APPAEYSALTPPLREPTGPLDTCRRCALWRNAKQPVPGAGAGAGAGAGAGAGAGAGAGGS
VSANADAHTNSTAPASPPIMVVGEQPGEYENQHGVPFTGPAGQLLDSVLARAGLERAALY
LTYAVKHYKWEIVGRERIHRTPAQREVEACQYWLEKELAQLAPRVVVALGPTALRALTGA
HVNLSEYMRGARSVMAGASSCRPGIRRMRCEPPTRVCATTSSQESRLRSGGRRNWRATLP
SVGDNRLSHAIARACTGTWLAQTLIAMRERRRTANRQ