Protein Info for ABIE53_005017 in Paraburkholderia graminis OAS925

Annotation: arabinogalactan endo-1,4-beta-galactosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07745: Glyco_hydro_53" amino acids 44 to 384 (341 residues), 401.3 bits, see alignment E=1.6e-124

Best Hits

KEGG orthology group: K01224, arabinogalactan endo-1,4-beta-galactosidase [EC: 3.2.1.89] (inferred from 76% identity to bgl:bglu_2g04090)

Predicted SEED Role

"Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)" in subsystem Lactose and Galactose Uptake and Utilization (EC 3.2.1.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ABIE53_005017 arabinogalactan endo-1,4-beta-galactosidase (Paraburkholderia graminis OAS925)
MNRREMLGWLASAAAAAGAGSMIGTPAMAADDVKTASRSGRFAKGADVSTLLELEANGAK
FYDHGVPHDCLLLLRSHGVDSIRIKVWNDPGNPNYFPADQSPRAGYNNAEHVRVLARRAA
ALGMRILIDFHYSDWWADPGKQYPPHAWAGKNITETCALLSEYTSNVLNMLKRDGVRPEW
VQVGNEITGGMLWPLGKYDQWDNLAQLLKAGHDAVKSVDERIKVMLHIDSGGNNATSRWW
FDSAIQRGVSFDMIGLSYYPQWQGALSDLQTNANDLATRYGKDVMVVETAYPWTTSDGDS
EPNAMTNTGSTTFPQTPAGQAQFLAAVADIVKAIPDGHGKGVFWWEPEWIPTPNVGWKVG
AGDQWDNNTLFDFHGNVLSSLDAFRKL