Protein Info for ABIE53_004956 in Paraburkholderia graminis OAS925

Annotation: uncharacterized protein YfaQ (DUF2300 family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details amino acids 33 to 34 (2 residues), see Phobius details amino acids 38 to 39 (2 residues), see Phobius details transmembrane" amino acids 16 to 32 (17 residues), see Phobius details amino acids 40 to 50 (11 residues), see Phobius details PF10062: DUF2300" amino acids 129 to 243 (115 residues), 77.8 bits, see alignment E=8.3e-26 amino acids 462 to 583 (122 residues), 149.1 bits, see alignment E=7.6e-48 PF08486: SpoIID" amino acids 368 to 448 (81 residues), 35.4 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_5087)

Predicted SEED Role

"FIG00456038: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>ABIE53_004956 uncharacterized protein YfaQ (DUF2300 family) (Paraburkholderia graminis OAS925)
MFLGTLVRSVRGRVAAMLRIAFAVAAMCVLFAANVERGYAAVPLASASAFVASGAASKQA
LRFAWLRDGQSQLWQADAGGAAVGLSPQSAVPLPATLETPLGSVWKLFVYGYLVDRNIAT
PDYTCSGGDPEEVYCCMTGGRIDREHALVQSCGRFFEPARLQLDPVDWRKYWTAANAPAW
LRNLHAMTPTQRVPVAQLLAALQAMPARPREAAASTLVSVLTSGRGEGTVSLYGSLLRAK
TWTMPDAARPGASVGGAAGWLADGPPIWLGGPGGSARVLASAAPRIAPLLTQFAVPDDGA
CVVVDFFSRYPIREVLGEHSSKRPAAMVPDGPLNGEFRVGFVNGNWARVTSRGELRLDRN
AAGVPQLIGRFGMNDYVARVVEREGDTAQPEAAKALAVAARTYAVQHGAHDHGCLRIDDS
SNTQRVLPHAPTAAARRAADLTDALVLTGVPVQYHHDKAAPGQMSWLAAKASAQTGLTFD
AILARTWPQATLTSFQSPLSGDCVAVAGAREWLQRNAPLWARRMDGAAGYETPDLPAVCA
VREGRPYADAQRNRVYVYRLQSEEDRIALAHEYVHLAFQHHPRGLDEDFVERTARVLIRT
DNPIQ