Protein Info for ABIE53_004916 in Paraburkholderia graminis OAS925

Annotation: CspA family cold shock protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00313: CSD
  • amino acids 3 to 66 (64 residues), 103.6 bits, E=2.1e-34

Best Hits

Swiss-Prot: 71% identical to CSPG_SHEVD: Cold shock-like protein CspG (cspG) from Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 91% identity to bvi:Bcep1808_4971)

Predicted SEED Role

No annotation

Protein Sequence (67 amino acids)

>ABIE53_004916 CspA family cold shock protein (Paraburkholderia graminis OAS925)
MDTGTVKWFNDSKGFGFITPDKGGDDLFAHFSEISGNGFKTLAENQKVSFETKQGPKGLQ
AANITPL