Protein Info for ABIE53_004811 in Paraburkholderia graminis OAS925

Annotation: tryptophan synthase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00290: Trp_syntA" amino acids 8 to 260 (253 residues), 290 bits, see alignment E=6e-91 TIGR00262: tryptophan synthase, alpha subunit" amino acids 8 to 258 (251 residues), 251.5 bits, see alignment E=3.1e-79

Best Hits

Swiss-Prot: 97% identical to TRPA_PARPJ: Tryptophan synthase alpha chain (trpA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 98% identity to bgf:BC1003_4587)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABIE53_004811 tryptophan synthase alpha chain (Paraburkholderia graminis OAS925)
MSRIKNTFAALSEQGKKGLIPFMTAGDPDPARTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQQSSERALAHGVSLRHVIADVKRFRETNDTTPVVLMGYANPIERMGTEAFAQAAKE
AGVDGVLVVDYPPEECANFAEKMRSAGIDPIFLLAPTSTDERIAEVGKIASGYVYYVSLK
GVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAETARLVGEVSDAVVIGSRIVQLL
EQAAPETAAETLTRFIAEVREALDSVATAR