Protein Info for ABIE53_004765 in Paraburkholderia graminis OAS925

Annotation: succinate dehydrogenase / fumarate reductase cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 18 to 130 (113 residues), 90.2 bits, E=5.5e-30
• TIGR02970: succinate dehydrogenase, cytochrome b556 subunit
  • amino acids 21 to 131 (111 residues), 116.2 bits, E=5.1e-38

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 91% identity to bge:BC1002_5197)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Protein Sequence (138 amino acids)

>ABIE53_004765 succinate dehydrogenase / fumarate reductase cytochrome b subunit (Paraburkholderia graminis OAS925)
MAEAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRLSGGLLFVALPFLLYLFDQSLTS
ELSFEVFKGFLSNLIVKLITLVLAWAYLFHFCAGVRHLLMDTNHEAVTKEKGKQTSIVVF
VVSSLLTIVFALKLFGAF