Protein Info for ABIE53_004635 in Paraburkholderia graminis OAS925

Annotation: L-histidine N-alpha-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 160 to 176 (17 residues), see Phobius details PF10017: Methyltransf_33" amino acids 18 to 323 (306 residues), 323 bits, see alignment E=8.4e-101 TIGR03438: dimethylhistidine N-methyltransferase" amino acids 18 to 319 (302 residues), 311 bits, see alignment E=4e-97

Best Hits

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_4512)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>ABIE53_004635 L-histidine N-alpha-methyltransferase (Paraburkholderia graminis OAS925)
MTQPAISHDASPDLRSAFAADVRAGLTHSPQKELPSKYLYDEVGSALFEVITVLPEYGVT
RAEERLLAKHAADIVEHLPHDVTVAELGSGSGRKTRRILEALCKKRPTSYCPIEISRSAL
QLCRRELGDIERISIVGYERDYLAGLAEVSKKRAADERLLVLFLGSTIGNFGRLAATRFL
RDIRNMLAPGDALLLGTDLIKPTPTLIAAYDDAIGVTASFNLNLLARINRELGGDFPLDA
FEHVARFNPDARSIEMHLRAKRDVSAHIAAAKLTVTLKAGETIWTESSHKYRADEMPAIA
DDAGFACSHQWVENEWGFAESLLVAR