Protein Info for ABIE53_004420 in Paraburkholderia graminis OAS925

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF13855: LRR_8" amino acids 38 to 71 (34 residues), 28.5 bits, see alignment 3.1e-10 amino acids 105 to 163 (59 residues), 32.3 bits, see alignment E=2e-11 amino acids 129 to 185 (57 residues), 27.6 bits, see alignment 5.9e-10 PF00560: LRR_1" amino acids 39 to 59 (21 residues), 13.9 bits, see alignment (E = 1.5e-05) PF07714: PK_Tyr_Ser-Thr" amino acids 208 to 372 (165 residues), 63.4 bits, see alignment E=6.6e-21 PF00069: Pkinase" amino acids 210 to 374 (165 residues), 57.4 bits, see alignment E=4.7e-19 PF06293: Kdo" amino acids 325 to 388 (64 residues), 25.7 bits, see alignment E=2.2e-09

Best Hits

KEGG orthology group: None (inferred from 89% identity to bug:BC1001_4541)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>ABIE53_004420 hypothetical protein (Paraburkholderia graminis OAS925)
MTTTLEQLRAGQLAGTRHLKLACGLSEFPREILDLADTLEVLDLSGNALTTLPDDFARLR
KLRILFASNNPFTELPPVLGQCPQLSMIGFKANRIRTVAGTALPPRLRWLILTDNEVDAL
PPEIGHCTHLQKLMLAGNRLRFLPEQLAACSRLELLRLAANRLDELPAWLFHMPRLAWLA
YAGNPFGEALEAAALDDTPIAEISWNDLRLHEQLGEGASGVIYRAELRTHENTARRVAVK
LFKGAVTSDGLPDCEMAACIRSGDHPNLIAVAGKVKDHPDNAHGLVMELIDPQYRNLAGP
PSFESCTRDIYAADVRFNPVDVVDMAHGIASAASHLHRQCVMHGDLYAHNILHDGQARVL
LGDFGAASFYSTENREAGVALERLEVRAYGCLLEELMTRCHWSDSRVQADVAVKLASLRD
SCLSEDVDKRPLFEQIASELLVLKAR