Protein Info for ABIE53_004221 in Paraburkholderia graminis OAS925

Annotation: NitT/TauT family transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 130 to 177 (48 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 221 to 221 (1 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 273 (170 residues), 53.1 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 92% identity to bxe:Bxe_A2172)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>ABIE53_004221 NitT/TauT family transport system permease protein (Paraburkholderia graminis OAS925)
MSSPATLLPPIRDEYERPLEPPGDFVLEAPLPLGKRVFAQSWVRKVLIALVLIAVWEIAA
RVVNNDLLLPTFGATFVAFAQGVLSGELLQKTAVSMSVLLRGYLLGAALAFVLTSLAVST
RVGRDLLSMLTAMFNPLPSIALLPIALLWFGLGTGSLLFVLVHSVLWPLALNTYSGFQSV
PATLRMTGRNYGLTGMRHVLLILMPAALPSILAGLRVGWAFAWRTLIAAELVFGASSGNG
GLGWYIFQNRNELYTDRVFAGLAAVIVIGLLIEHLVFDTLERVTVRRWGVQH