Protein Info for ABIE53_004178 in Paraburkholderia graminis OAS925

Annotation: putative spermidine/putrescine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 254 (174 residues), 54.8 bits, see alignment E=5.2e-19

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to bug:BC1001_4209)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>ABIE53_004178 putative spermidine/putrescine transport system permease protein (Paraburkholderia graminis OAS925)
MRKNGPVALIFHTLVIAFVLAPLVIVVLVAFTPDETLTLPTHGVSLRWFRAILNYPDFIA
AFVNSLKLAFASATLSLIVALPAALAIGRARFPGRAFLNGLLLSPLVIPGLVLGIALLRF
FAMIGATGSFTWLIVAHMIIITPFVMRLVLASVSGLDRSVEHAAHSLGADPWTTFRRITL
PMILPGITGGWLLAFINSFDELTMSIFVTSPQTVTLPVRMYMYATESIDPMMASVSALVI
FITAGAMLLLDRVYGLNRILIGQH