Protein Info for ABIE53_004172 in Paraburkholderia graminis OAS925

Annotation: oligopeptide transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF00005: ABC_tran" amino acids 25 to 182 (158 residues), 110.6 bits, see alignment E=1.5e-35 PF13304: AAA_21" amino acids 137 to 217 (81 residues), 34.2 bits, see alignment E=4.3e-12 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 232 to 328 (97 residues), 66 bits, see alignment E=1.3e-22 PF08352: oligo_HPY" amino acids 233 to 307 (75 residues), 58.7 bits, see alignment E=8.9e-20

Best Hits

Swiss-Prot: 53% identical to Y1094_BRUSU: Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 (BRA1094) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 90% identity to bgf:BC1003_5210)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppD (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>ABIE53_004172 oligopeptide transport system ATP-binding protein (Paraburkholderia graminis OAS925)
MPLLEVKDLSVRFTRREGAPVDAVQRVSFSLEAGRTLGIVGESGSGKSQTVMAMLGLLAG
NGKVSGEARYRGDNLLAMKESELNRIRGNRIGMIFQDPMTSLNPFLTIERQMTETLQLHR
KMTRREARRRAVEALESVRIPDAPRRIGMYPHEFSGGMRQRVMIAMALLSEPEILIADEP
TTALDVTVQAQIIELLRELNRERGTAIILITHDMGVVAGLCDDVMVMYAGQTVEQASAAA
LFAAPTHPYTRGLLNALPRLTSDDISGTGDSDDDRPLQTIPGNPPLPGEIVAGCAFAPRC
TYCTDVCRESRPSLVTADGYPEARRACHRPVSEILEAQHV