Protein Info for ABIE53_004108 in Paraburkholderia graminis OAS925

Annotation: acetyl esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF20434: BD-FAE" amino acids 45 to 147 (103 residues), 53 bits, see alignment E=5e-18 PF00135: COesterase" amino acids 47 to 151 (105 residues), 49.8 bits, see alignment E=4.2e-17 PF07859: Abhydrolase_3" amino acids 55 to 259 (205 residues), 183 bits, see alignment E=1e-57

Best Hits

KEGG orthology group: None (inferred from 97% identity to bug:BC1001_4142)

Predicted SEED Role

"Esterase/lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>ABIE53_004108 acetyl esterase (Paraburkholderia graminis OAS925)
MEAFKPPYSFVPAGIAPAGADSTALEVTDVQIEGHAQDITLRLYRQPKKTALPVLLYFHG
GGFTKGSIDQADFASRYFAEHLPALVVSVGYSLAPQFPFPAAPEDAHRAALWVQTRARAF
GGNSRKVGVAGHDAGGQLANCLAFIARDRGDVQISAQALFGPMLDPSLTRLGDEKRLGSD
ITARECAACYRAYLPQASQRMHPYAAPLESSRLAGLPATLIATAQNDVLHVEAEKYASSL
IDAGVLTQVVRYPAVSHAALADHPPALQEAVRFFQWRFDARAHR