Protein Info for ABIE53_004072 in Paraburkholderia graminis OAS925

Annotation: gamma-glutamylputrescine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 25 to 242 (218 residues), 30.3 bits, E=4e-11
• PF01266: DAO
  • amino acids 25 to 376 (352 residues), 236.2 bits, E=1.3e-73

Best Hits

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 92% identity to bgf:BC1003_5310)

Predicted SEED Role

"Lysine-specific permease" in subsystem YeiH

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.-

Use Curated BLAST to search for 1.4.3.-

Protein Sequence (429 amino acids)

>ABIE53_004072 gamma-glutamylputrescine oxidase (Paraburkholderia graminis OAS925)
MDNFYEATVARPSAYAPIAGRHSVDVCIVGGGLAGLSTALGLAERGVANVALLEARQVGF
GASGRNGGFVFGGYSLDCADLLKTLGAVRARELYALTTDAVDLMRARIARYRIDCDATDA
GVILANWFDEPARLDAQRRLMRDSFGVDWEPLTADQLASQLKTRRYHGGLFERNAFHFHP
LKYVLGVANAAANAGVQIYEQSPVVRLQREGAGFIVQTPQGAIDARHVVMAGGGYARNVH
AKVERAVLPIATYVMATEPLGARLQDAIDTRAAVYDTRFAFDYYRPLPDTRILWGGRISV
RDRAPEVIARLLRRDLLKVYPQLHDVRIDYAWGGLMSYARHKMPQIGRGADGVWHAVGFG
GHGMAPTTVSGELLAAAIAGERPVPEAFAAFGLTPAYGALGLAAAQLTYTAMQTRDALAA
RRRLSRRPH