Protein Info for ABIE53_004003 in Paraburkholderia graminis OAS925

Annotation: putative MFS family arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 291 (267 residues), 79.6 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_4053)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>ABIE53_004003 putative MFS family arabinose efflux permease (Paraburkholderia graminis OAS925)
MSTTSSKRFTPAFNHTTLVILAAALVLSAAMGIRQTFGLFIGPFSFDRGLPVTLIAFAIA
LHNLVWGFAQPFAGAAADRYGSAPVVAFGATTFAAGLGLAAATPSGPLLIVGMGLLVGIG
VSCTTFGVVLPAVGRVASPEKRSMAMGLVSAGGSVGQVLMVPLVQGIRLHAGIATSLFVL
AFVMLMVAPLGIVLDRRAPVGAPRHEAPAAPLRDTLAQAARHRGYRLLTLGFFTCGFQLA
FIATHLPGYLSLCHMPIGLGATALALIGLFNMVGSWGCGWLGGRFRQHHVLGWLYLIRSA
TIGAFFVLPKSAVTVVLFAAVMGLTWLGTVPLTSGLVAKVFGTRHLGSLFGVCFLSHQIG
SFLGAWLGGVVFDLTGSYSLLWQATVASGLIAALLHFPIDDTALPTPALRSEPASA