Protein Info for ABIE53_003919 in Paraburkholderia graminis OAS925

Annotation: RNA polymerase sigma-70 factor (ECF subfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 160 (145 residues), 69.1 bits, see alignment E=1.7e-23 PF04542: Sigma70_r2" amino acids 17 to 78 (62 residues), 47.6 bits, see alignment E=1.8e-16 PF08281: Sigma70_r4_2" amino acids 109 to 159 (51 residues), 62.4 bits, see alignment E=3.9e-21 PF04545: Sigma70_r4" amino acids 114 to 158 (45 residues), 36.6 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_4181)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>ABIE53_003919 RNA polymerase sigma-70 factor (ECF subfamily) (Paraburkholderia graminis OAS925)
MSTADVENLPSLLPGMLPRLWAFSLRLCGNQHDAEDLLQRACVRGLERAHQLQPGTSPLS
WMFSIVHSTWLNELRARNVRSRSSMEWDDNFLETVPDPGARNPADSVSEIIAAVERLPDA
QRTVMLLVAVEGFSYAEAAEVLGVPIGTIMSRLSRARQTIGAQFSDHDTSSARSSKNQRA
AQ