Protein Info for ABIE53_003752 in Paraburkholderia graminis OAS925

Annotation: cytochrome c-type biogenesis protein CcsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 346 to 363 (18 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details TIGR03144: cytochrome c-type biogenesis protein CcsB" amino acids 164 to 401 (238 residues), 247.3 bits, see alignment E=1e-77 PF01578: Cytochrom_C_asm" amino acids 195 to 398 (204 residues), 168.8 bits, see alignment E=6.8e-54

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_3247)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcsA/ResC" in subsystem Biogenesis of c-type cytochromes or Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>ABIE53_003752 cytochrome c-type biogenesis protein CcsB (Paraburkholderia graminis OAS925)
MDLTQVSSSSPSSSRPARAAADEALNAAQYDERPFLKRLGIVDWLFALAMVAGAGFALTR
YHPFMNYYDKLVLVCSVPVFVVLGWRWKPVRPLMAGIAALSLLAIQIYHGDLSRADNAFF
LKYFLSSQSAILWMSALFVFATVFYWIGLLSRSPTGGAIGSRMTWVAVLMGFVGLMVRWY
ESYLIGADVGHIPISNLYEVFVLFSLITALFYLYYEQHYNTRALGAFVLLVISAAVGFLM
WYSVARDAQQIQPLVPALQSWWMKIHVPANFIGYGSFALSAMVAVAYLAKERGVLADRLP
ALEVLDDVMYKSIAVGFAFFTIATILGALWAAEAWGGYWSWDPKETWALIVWLNYAAWLH
MRLMKGLRGAVAAWWALTGLLVTTFAFLGVNMFLSGLHSYGKL