Protein Info for ABIE53_003748 in Paraburkholderia graminis OAS925

Annotation: putative small lipoprotein YifL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13627: LPAM_2" amino acids 27 to 44 (18 residues), 23.9 bits, see alignment 1.4e-09

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_3243)

Predicted SEED Role

"FIG00453728: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>ABIE53_003748 putative small lipoprotein YifL (Paraburkholderia graminis OAS925)
MRVVSRMRAAAPGRAIVAGLAILAGCALGGSLTGCGQRGSLYLPTVPPLPAKPIDRTQPP
SPDEVKPGAETAADSDSIPDTSGTPLSLAPADELSASPTSAASAASASKAASQPTSQPAA
TPAQ