Protein Info for ABIE53_003664 in Paraburkholderia graminis OAS925

Annotation: release factor glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF17827: PrmC_N" amino acids 17 to 78 (62 residues), 55.7 bits, see alignment E=2.1e-18 TIGR00536: methyltransferase, HemK family" amino acids 24 to 283 (260 residues), 224.6 bits, see alignment E=1.4e-70 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 28 to 282 (255 residues), 287.1 bits, see alignment E=1.2e-89 PF03602: Cons_hypoth95" amino acids 98 to 201 (104 residues), 25.7 bits, see alignment E=2.9e-09 PF05175: MTS" amino acids 108 to 201 (94 residues), 54.1 bits, see alignment E=5.2e-18 PF06325: PrmA" amino acids 111 to 195 (85 residues), 22.2 bits, see alignment E=3.2e-08 PF13847: Methyltransf_31" amino acids 118 to 197 (80 residues), 45.7 bits, see alignment E=2.1e-15 PF13649: Methyltransf_25" amino acids 119 to 195 (77 residues), 36.9 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 70% identical to PRMC_BURPS: Release factor glutamine methyltransferase (prmC) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 90% identity to bgf:BC1003_3123)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>ABIE53_003664 release factor glutamine methyltransferase (Paraburkholderia graminis OAS925)
MTANAPPNRDQAATPAALLRASPLPPLEARILLTHVLGWRHTQLITRADEALDSECVERY
LALQARRVAGEPIAQLVGVREFFGLEFEVTPHVLIPRPETELLVETALTAMENLPRPRVL
DLGTGTGAIALAIASMRPDAQMTALDRSAEALAVAARNAARLLDAKRPGGAVTFAQSDWY
GSLDTALRFDVIVSNPPYIASGDPHLEQGDLRYEPRGALTDEADGLSAIRAIVAGAPARL
AARGVLWMEHGYDQAEAVRELLTGQGFVDVRSERDLAGIERISGGRLAG