Protein Info for ABIE53_003305 in Paraburkholderia graminis OAS925

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF17871: AAA_lid_9" amino acids 2 to 82 (81 residues), 60 bits, see alignment E=5.5e-20 PF07724: AAA_2" amino acids 116 to 276 (161 residues), 200 bits, see alignment E=8.4e-63 PF00158: Sigma54_activat" amino acids 120 to 241 (122 residues), 25.9 bits, see alignment E=2.3e-09 PF07728: AAA_5" amino acids 121 to 238 (118 residues), 50.2 bits, see alignment E=8.2e-17 PF00004: AAA" amino acids 122 to 237 (116 residues), 50.9 bits, see alignment E=6.9e-17 PF10431: ClpB_D2-small" amino acids 283 to 363 (81 residues), 83.7 bits, see alignment E=2.3e-27

Best Hits

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>ABIE53_003305 ATP-dependent Clp protease ATP-binding subunit ClpA (Paraburkholderia graminis OAS925)
MKYSSGALSAAAELSARFITDRHLPDKAIDVIDEAGAAQRILPKSKQKKTIGKNEIEEII
SKIARVPPQSVSQDDRSKLQTLDRDLKSVVFGQDPAIDALSAAIKMARAGLGKLDKPIGA
FLFSGPTGVGKTEVAKQLAFTLGIELIRFDMSEYMERHAVSRLIGAPPGYVGFDQGGLLT
EAVTKKPHCVLLLDEIEKAHPDIYNVLLQVMDHGTLTDNNGRKADFRNVIIIMTTNAGAE
AMGKSVIGFTNRRETGDEMVDIKRMFTPEFRNRLDATISFRALDEEIIMRVVDKFLMQLE
DQLHEKKVDALFTDALRKHLAKHGFDPLMGARPMQRLIQDTIRRALADELLFGKLMNGGR
VSVDVDAEDKVQLTFDEHPAPRNPNPEAVEVE