Protein Info for ABIE53_003053 in Paraburkholderia graminis OAS925

Annotation: septum formation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00172: septum formation protein Maf
  • amino acids 8 to 194 (187 residues), 141.9 bits, E=8.5e-46
• PF02545: Maf
  • amino acids 10 to 194 (185 residues), 170.2 bits, E=2.1e-54

Best Hits

Swiss-Prot: 86% identical to NTPPB_PARXL: 7-methyl-GTP pyrophosphatase (Bxeno_A3340) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06287, septum formation protein (inferred from 90% identity to bug:BC1001_2553)

MetaCyc: 48% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"FIG146278: Maf/YceF/YhdE family protein"

Protein Sequence (205 amino acids)

>ABIE53_003053 septum formation protein (Paraburkholderia graminis OAS925)
MPDSPQSPSRLILASSSPYRRELLERLRVPFDVAVPAIDETPHAGETPEATALRLAEAKA
RAVARTFSPDQAVLVIGSDQVATYDGLQIGKPGTHDKALAQLQAMRGREVLFHSALCLFD
SRSGAAQTVDVVTRVQFRDLPDAALEAYLRAETPYDVAGSAKSEGLGIALLEAIHSDDPT
ALIGLPLIALSGMLLTAGYPLLGAQ