Protein Info for ABIE53_003027 in Paraburkholderia graminis OAS925

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF08207: EFP_N" amino acids 3 to 60 (58 residues), 67.6 bits, see alignment E=1.1e-22 TIGR00038: translation elongation factor P" amino acids 3 to 185 (183 residues), 211 bits, see alignment E=5.7e-67 PF01132: EFP" amino acids 68 to 120 (53 residues), 61.9 bits, see alignment E=6.7e-21 PF09285: Elong-fact-P_C" amino acids 130 to 184 (55 residues), 82.1 bits, see alignment E=2.7e-27

Best Hits

Swiss-Prot: 97% identical to EFP_PARPJ: Elongation factor P (efp) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02356, elongation factor P (inferred from 97% identity to bxe:Bxe_A1093)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>ABIE53_003027 elongation factor P (Paraburkholderia graminis OAS925)
MKTAQELRTGNVVMIGTDAMVVQKAEYNKSGRNSAVVKMKFKNLLTGAGMESVYKADDKF
DVVVLERKEVTYSYFADPMYVFMDADYNQYEVEAEMMGDAMNYLEDGMACEVVFYNEKAI
SVELPTTLVREIIYTEPAVKGDTSSGKVLKNAKLNTGFELQVPLFCNIGDKIEIDTRTHE
YRSRA