Protein Info for ABIE53_002973 in Paraburkholderia graminis OAS925

Annotation: undecaprenyl-diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details PF02673: BacA" amino acids 7 to 264 (258 residues), 252.2 bits, see alignment E=3.4e-79

Best Hits

Swiss-Prot: 97% identical to UPPP2_PARXL: Undecaprenyl-diphosphatase 2 (uppP2) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 97% identity to bug:BC1001_2479)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>ABIE53_002973 undecaprenyl-diphosphatase (Paraburkholderia graminis OAS925)
MNLSFLIFLSVLQGVTELFPVSSLGHTLLIPALFGMHIDKHAPQLLPFLVALHLGTAFAL
LWYFRERWCALVRGFFASFGGRRNDDAHMMWALIIGTIPAGLVGLLLEKRLERIFHDLRI
VAIALIVNGVLLWVGDRLQRSRAHQAPEKMTFRQAFFVGLAQVGALIPGFSRSGLTMIAG
NAAGLTAEKAAEFSFLLGTPIIFAAGLLELPKLFHAPGQLADALLGGVLTAIAAYLSVRF
LMRYFEGRGRLASFGVYCVIAGIVFLGWFALHPQPV