Protein Info for ABIE53_002912 in Paraburkholderia graminis OAS925

Annotation: NAD(P)-dependent dehydrogenase (short-subunit alcohol dehydrogenase family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 208 (199 residues), 197.2 bits, E=4e-62
• PF08659: KR
  • amino acids 12 to 129 (118 residues), 57 bits, E=5e-19
• PF01370: Epimerase
  • amino acids 12 to 190 (179 residues), 29 bits, E=1.4e-10
• PF13561: adh_short_C2
  • amino acids 16 to 255 (240 residues), 198.2 bits, E=3.4e-62

Best Hits

Swiss-Prot: 34% identical to DTHD_MYCS2: D-threitol dehydrogenase (dthD) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 98% identity to bxe:Bxe_A1363)

MetaCyc: 34% identical to D-threitol dehydrogenase (Mycolicibacterium smegmatis)
ERYTHRULOSE-REDUCTASE-RXN [EC: 1.1.1.403]

Predicted SEED Role

"3-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 1.1.1.30)

MetaCyc Pathways

• ketolysis (3/3 steps found)
• ketogenesis (4/5 steps found)
• D-threitol degradation (1/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Synthesis and degradation of ketone bodies
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.30

Use Curated BLAST to search for 1.-.-.- or 1.1.1.30 or 1.1.1.403

Protein Sequence (258 amino acids)

>ABIE53_002912 NAD(P)-dependent dehydrogenase (short-subunit alcohol dehydrogenase family) (Paraburkholderia graminis OAS925)
MGRSINLEGKVALITGASSGLGKRFAQVLSQAGAKVVLASRRTERLKELRAEIEASGGAA
HVVSLDVTDYQSIKSAVAHAETEAGTIDILVNNSGVSTTQKLSEVTPADFEYVFDTNTRG
AFFVAQEVAKRMIMRGNNAQKPSYRIINIASMAGLRVLPQIGLYSMSKAAVVHMTKAMAL
EWGKHGINVNAICPGYIDTEINHHHWSTEQGQKLVSMLPRHRVGKPEDLDGLLLLLAADE
SQFINGSVIAADDGFGLA