Protein Info for ABIE53_002899 in Paraburkholderia graminis OAS925

Annotation: phenylalanyl-tRNA synthetase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF02912: Phe_tRNA-synt_N" amino acids 19 to 86 (68 residues), 70.3 bits, see alignment E=1.1e-23 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 37 to 336 (300 residues), 333.1 bits, see alignment E=9.2e-104 PF01409: tRNA-synt_2d" amino acids 91 to 336 (246 residues), 322.2 bits, see alignment E=2.3e-100

Best Hits

Swiss-Prot: 97% identical to SYFA_PARPJ: Phenylalanine--tRNA ligase alpha subunit (pheS) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 99% identity to bgf:BC1003_2378)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>ABIE53_002899 phenylalanyl-tRNA synthetase alpha chain (Paraburkholderia graminis OAS925)
MDLDQIVADAQKAFAEASDVTTLENEKARFLGKSGALTELLKGLGKLDPETRKTEGARIN
LVKQQVEAALTARRQALADALLNQRLAAEAIDVTLPGRGAHAGSLHPVMRTWERVEQIFG
SIGFDVADGPEIETDWYNFTSLNSPENHPARSMQDTFYVDGKDADGRQLLLRTHTSPMQV
RYARTNTPPIKVIVPGRTYRVDSDATHSPMFNQVEGLWIEENISFADLKGVYTDFLKKFF
ERDDIQVRFRPSYFPFTEPSAEIDMLFETGKNAGKWLEISGSGQVHPTVIRNMGLDPERY
IGFAFGSGLERLTMLRYGVQDLRLFFENDLRFLRQFA