Protein Info for ABIE53_002861 in Paraburkholderia graminis OAS925

Annotation: drug/metabolite transporter (DMT)-like permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF00892: EamA" amino acids 23 to 154 (132 residues), 63.5 bits, see alignment E=1.2e-21 amino acids 177 to 305 (129 residues), 63.9 bits, see alignment E=8.7e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_2372)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>ABIE53_002861 drug/metabolite transporter (DMT)-like permease (Paraburkholderia graminis OAS925)
MHRRLDSTARDATIMNAKNLFQLLILAALWGASFLFIRVGVTDFGVAPLMALRVGIGAAF
LIVVLLARRPLQQSATILRTRAFPLLVVGILNSAAPFCLFAYAELTLSAGVTSVINATTP
LWGGLVAFVWLRDRLTGLRTLGLAIGFLGVLMLVWDQIATPSGSAATPLTTALAAGAALG
ATLLYGIAANYTKRYLTGVDALTVAAGTMTGATIVLLPLAVIYWPSAPVSLHAWGAVIAL
GVACTGVAYMLFFHLIAVAGPARAITVTFVIPIFGILWGALFLGEGVSAGMLEGCGVILV
GTALATGVIKRLPWLGTRRADT