Protein Info for ABIE53_002851 in Paraburkholderia graminis OAS925

Annotation: drug/metabolite transporter (DMT)-like permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details PF00892: EamA" amino acids 31 to 155 (125 residues), 54.6 bits, see alignment E=6.7e-19 amino acids 166 to 299 (134 residues), 54.2 bits, see alignment E=9.1e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_1096)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABIE53_002851 drug/metabolite transporter (DMT)-like permease (Paraburkholderia graminis OAS925)
MSQELPGWFSRGFPIRLPQSRNGQIALALGVVYLVWGSTYLAVHVALGSFPPLLMSGLRN
LFAGVGLFAFAARRNPVWPSAAEIRNAGLVGTMLVGLSSGMLAYGMRTVGTGTAAVMVAT
VPLFATVIAAVAGRKIGRGEWFAVGLGLVGIAILSHGDDTPGSAGGSLAILCGALFWAGG
AHLAGRLKLPSDLFLSTSLQIGLGGAMSTMVAWVSGERMLEVHFLPVLAFIYLMLIGTMA
AYVAYGFLIRHTSPIIASSCMYVNPVVAVALGALLLGEPVTHSTVIATVVILVSVGLSFW
LDYRKKALA