Protein Info for ABIE53_002794 in Paraburkholderia graminis OAS925

Annotation: PAS domain S-box-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 821 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 321 to 446 (126 residues), 92 bits, see alignment E=1.6e-30 PF13188: PAS_8" amino acids 323 to 365 (43 residues), 32.3 bits, see alignment 2.7e-11 PF00989: PAS" amino acids 325 to 436 (112 residues), 66.9 bits, see alignment E=6.5e-22 PF08448: PAS_4" amino acids 337 to 441 (105 residues), 54.9 bits, see alignment E=4e-18 PF13426: PAS_9" amino acids 338 to 438 (101 residues), 54.7 bits, see alignment E=4.3e-18 PF08447: PAS_3" amino acids 346 to 430 (85 residues), 32.6 bits, see alignment E=3.3e-11 PF00512: HisKA" amino acids 592 to 659 (68 residues), 28.1 bits, see alignment E=7.1e-10 PF02518: HATPase_c" amino acids 704 to 801 (98 residues), 64.5 bits, see alignment E=4.7e-21

Best Hits

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_2305)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (821 amino acids)

>ABIE53_002794 PAS domain S-box-containing protein (Paraburkholderia graminis OAS925)
MPRMLTERLFARSARNAGSPADSSPSSRWHHGPWWSNSYLLTPLLSILVFLVVMSLILWS
LNRREQQQQEDTLYRNVAWAQQQIRLSMTGAQEQIQALARDLAAGHADPQSFQVSTTDIM
QGHPEILYMNWYTSQQQPRWPNTALPVFGQRLAKPNDTQMDEAVKAAFAEARSTRRQVYS
PLIYDDLGNGYITLQTPVFRDREFLGSIAAVFSVEGILKHDIPPELSAKYKISIVDANNR
ELTTTSTRPRLPRDMFYDLPLDPPGQGVSVRVYAFPQMTNFTNNTLVWLVAGLSCFVLWS
LWSLWKHTRQRFEAQQALYAEAFFRRAMENSVLIGMRVLDMHGRITHVNPAFCRMTGWDE
SDLVGKTAPFAYWPRDAYPEMQRQLDMTLRGKAPSSGFELRVRRKDGSTFHARLYVSPLI
DSSGRQTGWMSSMTDITEPKRAREELAAAHERFTTVLESLDAAVSVLAADEAELLFANRY
YRHLFGIRPDGHLELAGGGFDSAQASSDSIDMVDTYAGLPAAALTESTADAQEIYVQSIQ
KWFEVRRQYIQWVDGHLAQMQIATDITTRKQAQELSRQQDEKLQFTSRLMTMGEMASSLA
HELNQPLAAINNYCSGTVALVKSGRTTPDNLLPVLEKTAQQAVRAGMIIKRIREFVKRSE
PKRQATRVADIVADAVGLAEIEVRKRRIRIVTDMRSRLPVIYVDPVLIEQVLVNLLKNGA
EAMAEARPNAVDPVIRVVVRLEGGFVNISVVDQGPGVDEATAERLFEPFYSTKSDGMGMG
LNICRSIIESHRGRLWVVNNVGVRRPHHRRHVPLQSAYWRA