Protein Info for ABIE53_002792 in Paraburkholderia graminis OAS925

Annotation: pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 PF00364: Biotin_lipoyl" amino acids 6 to 77 (72 residues), 75.6 bits, see alignment E=5.5e-25 amino acids 122 to 192 (71 residues), 73 bits, see alignment E=3.5e-24 TIGR01348: dihydrolipoyllysine-residue acetyltransferase" amino acids 100 to 553 (454 residues), 648.3 bits, see alignment E=5.9e-199 PF02817: E3_binding" amino acids 250 to 283 (34 residues), 60.6 bits, see alignment (E = 3.4e-20) PF00198: 2-oxoacid_dh" amino acids 327 to 552 (226 residues), 279.2 bits, see alignment E=6.2e-87

Best Hits

Swiss-Prot: 72% identical to ODP2_CUPNH: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 95% identity to bgf:BC1003_1154)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>ABIE53_002792 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) (Paraburkholderia graminis OAS925)
MSQAIEVKVPDIGDYKDIPVIEVLVKAGDTVEKEQSLVTLESDKATMDVPSSAAGVVKEV
KVKVGDNVSEGSLIVVLDGAEGGAAAAAPAAAPAPAPAATPAPAPAAAPAAAPAASGGGL
QEVKVPDIGDYKDIPVIEVAVKVGDRVEKEQSLVTLESDKATMDVPSSAAGVVKEVKVKV
GDTVSEGSVIVVVEAEGGAAAPAPAPAAKPQAEKPSDAPAAPSPAPAAPSALAQAPSIPA
GEGGSRRASHASPSVRKFARELGVDVTQVQGTGPKGRITQADVTAFIKGVMTGQRAAPAG
AAVPAAGGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEAD
ITELEALRVQLNKENEKAGVKITMLAFVIKAVVSALKKFPTFNASLDGDNLVFKQYYHVG
FAADTPNGLVVPVIRDADKKGLVEIAKEMTDLSKAAREGKLKPDQMQGGCFSISSLGGIG
GTNFTPIINAPEVAILGLSRGAMKPVWDGKQFVPRLMLPLSLSYDHRVIDGAEAARFNAY
LGAILADFRRVIL