Protein Info for ABIE53_002772 in Paraburkholderia graminis OAS925

Annotation: peptide chain release factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR00020: peptide chain release factor 2" amino acids 2 to 287 (286 residues), 460 bits, see alignment E=2.6e-142 PF03462: PCRF" amino acids 3 to 144 (142 residues), 154.6 bits, see alignment E=3e-49 PF00472: RF-1" amino acids 153 to 261 (109 residues), 147.4 bits, see alignment E=1.7e-47

Best Hits

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 98% identity to bxe:Bxe_A1562)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>ABIE53_002772 peptide chain release factor 2 (Paraburkholderia graminis OAS925)
MRDAQDLFEMAREEGDDETLVACEADAQALEQRVADMEFRRMFANPADPNNAFLDIQAGA
GGTEACDWAAMLLRQYLRYCERKGFKTEVLEQTDGDVAGIKNATIKIEGEYAYGFLRTET
GVHRLVRKSPFDSSGGRHTSFSSVFVYPEVDDSIEVDINPADLRIDTYRASGAGGQHINK
TDSAVRITHMPSGIVVQCQNDRSQHRNRAEAMAMLKSRLYEAEIRKRQAEQDKLEAGKTD
VGWGHQIRSYVLDNSRIKDLRTNVEISNTKSVLDGDLDPFISASLKQGV