Protein Info for ABIE53_002752 in Paraburkholderia graminis OAS925

Annotation: Zn-dependent protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details PF02163: Peptidase_M50" amino acids 137 to 189 (53 residues), 31 bits, see alignment E=8.2e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_1194)

Predicted SEED Role

"FIG004556: membrane metalloprotease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>ABIE53_002752 Zn-dependent protease (Paraburkholderia graminis OAS925)
MDSSLIQTIAVYALPVIFAITLHEAAHGYVARWLGDNTAYVLGRVSINPMRHIDPLGTIA
IPLLLYFATSGAFMFGYAKPVPVAFGNLRNPRWGSLWVAAAGPGCNFVQALIWGLFGVAL
AVMAVDEPFFTRMAGAGVGVNLVLGVLNLFPLPPLDGGRVLMALLPPRQAIALSRLEPYG
FFIVMALVMTGTLTRYWLSPLVALGYSGITAILTPLVSLF