Protein Info for ABIE53_002587 in Paraburkholderia graminis OAS925

Annotation: DHA2 family multidrug resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 318 to 330 (13 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details PF07690: MFS_1" amino acids 2 to 235 (234 residues), 56 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: None (inferred from 78% identity to bpy:Bphyt_1697)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>ABIE53_002587 DHA2 family multidrug resistance protein (Paraburkholderia graminis OAS925)
MLIGVLCPFAPNLPALYALRVLQGIAGGCLPPMLIIAALRYLPPKIKLYGLAGYALTATF
GPSLATPLAALWTEYVDWRMAFWQIVPLGLISCVAIQQGLPDESSKTERFKSFNWTGFVT
GFPAIAMLVIGLLQGDRLDWLNSGFIRVMLGGGTLLLAAFLINEWFHPSPFFGLQLLRRR
NFTHGLITLAGAVILLTGVAVIPAQYLAKVHGYRPLQTAPLALLVAIPLLIALPLTAALL
NMQRVDRRWVIAIGLSLMATTCFLGSYMTSEWIRDNFYWLQSLQIAAQPMVILSILMGVT
GGLPPTEGPLASAMFNTLKVFAGVAATGLIEGLGTARQHFHSSMLVDRLGNNALITTQSV
DANHGFGALAQRIHEQAIVLTSADLYRVMACIAVALLFLVPVLPTRIYPPWSTTPPSSR