Protein Info for ABIE53_002531 in Paraburkholderia graminis OAS925

Annotation: uracil-DNA glycosylase family 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR00758: uracil-DNA glycosylase, family 4" amino acids 210 to 370 (161 residues), 205.4 bits, see alignment E=2.6e-65 PF03167: UDG" amino acids 224 to 370 (147 residues), 135.3 bits, see alignment E=8.5e-44

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 69% identity to bge:BC1002_1797)

Predicted SEED Role

"Uracil-DNA glycosylase, family 4"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>ABIE53_002531 uracil-DNA glycosylase family 4 (Paraburkholderia graminis OAS925)
MALHESVLEEFGLAPRWVRRGMGAVQEAAAGLSDEPQGTRADDAVHARTSVETGPRADGV
QTPRAPALPRERSQSAEPAGRAAESTRFVESAQQGAEKHDRAAPPASQARQQQRVQPAAD
GSDPRTAQPSRTPEPEREPSIAASDEPAVAQPPRTSEPSSFDAPPDDGFAWFDDLPLHPP
GEGDADAAMPALPAIDTLDWDALSERVSTCERCRLCEKRTKTVFGVGDRNADWMLIGEAP
GENEDRVGEPFVGQAGKLLDNMLRSLTLARDSNVYIANVIKCRPPGNRNPEPDEVARCEP
YLQRQVALVKPKLIVALGRFAAQSLLKTDASISSLRGRVHEYEGVPVIVAYHPAYLLRSL
PDKAKAWADLCLARDTWREAGGESSNAASQ