Protein Info for ABIE53_002483 in Paraburkholderia graminis OAS925

Annotation: regulator of protease activity HflC (stomatin/prohibitin superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01145: Band_7" amino acids 23 to 194 (172 residues), 118.8 bits, see alignment E=2.8e-38 PF16200: Band_7_C" amino acids 243 to 303 (61 residues), 95.3 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 40% identical to QMCA_ECO57: Protein QmcA (qmcA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_1307)

Predicted SEED Role

"Putative stomatin/prohibitin-family membrane protease subunit YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>ABIE53_002483 regulator of protease activity HflC (stomatin/prohibitin superfamily) (Paraburkholderia graminis OAS925)
MDSTIIGAVLLVIVIVLAAQTIKIVPQQHAWVLERLGRYHRTLTPGLSFAFPFVDRIAYK
HILKEIPLEVPSQVCITRDNTQLQVDGVLYFQVTDPMKASYGSSNFVFAITQLSQTTLRS
VIGKLELDKTFEERDFINHSIVSSLDEAAANWGVKVLRYEIKDLTPPKEILHAMQAQITA
EREKRALIAASEGRKQEQINIASGGREAAIQKSEGERQAAINQAQGQAAAILAVAEANSQ
AIQKIAAAIQSHGGMEAVNLKVAEQYVNAFGNLAKQGTTLIVPGNLADMSSMIASALTIV
NKGKSGVAEAR