Protein Info for ABIE53_002335 in Paraburkholderia graminis OAS925

Annotation: LacI family kdg operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00356: LacI" amino acids 15 to 61 (47 residues), 46.2 bits, see alignment 4.8e-16 PF00532: Peripla_BP_1" amino acids 74 to 219 (146 residues), 46.7 bits, see alignment E=4.7e-16 PF13377: Peripla_BP_3" amino acids 182 to 364 (183 residues), 56.4 bits, see alignment E=6.2e-19

Best Hits

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_1870)

Predicted SEED Role

"2-ketogluconate utilization repressor PtxS" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>ABIE53_002335 LacI family kdg operon repressor (Paraburkholderia graminis OAS925)
MSATPTSQGAPRRATITDVAREAGTGKTSISRYLNGEMSVLSPELRARIEAAIERLDYQP
NQMARGLKRGRNRLIGMLLADLTNPYTVEVLQGVEAACHALGLMPLICHAANEVEMERRY
LQLLTTYRVEGVIVNALGVREETLRPVGGGGIPAVLVDRSVEGLAADIVGLDNRAAAELG
TRHLLDRGFREIWFVVQPFEQVSSRRLREAAFRDAMRAHADAGAHADADASAAQGHTLVL
NLADVAQTDHSLAELDRAIDTAHQRAGRIGVDARIAVFAANAPVALRLALHLKARYGDAW
QTRVALLSIDDPEWAELTGITTIRQPTYDIGYRAVEFLHERIEGVQTTARDCLLPGELIV
RASTAS