Protein Info for ABIE53_002299 in Paraburkholderia graminis OAS925

Annotation: EmrB/QacA subfamily drug resistance transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details amino acids 430 to 451 (22 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 405 (391 residues), 156.9 bits, see alignment E=7e-50 amino acids 268 to 449 (182 residues), 41.6 bits, see alignment E=8.1e-15 PF06609: TRI12" amino acids 29 to 246 (218 residues), 35.7 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_1539)

Predicted SEED Role

"Predicted trehalose permease, MFS family" in subsystem Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>ABIE53_002299 EmrB/QacA subfamily drug resistance transporter (Paraburkholderia graminis OAS925)
MTAARTALIAPLIVACAMFMESVDANVIVTALPAMARDFGRDPVALKIAVTSYVLGLGVF
IPVCGWLADRFGARTVFRTAIGIFVAGSLLCAASNSLATFTLARFVQGVGGAMMVPVGRI
IIFRVVHKADFIRAMNYLSVPAMLGPAAGPLLGGFITTYLHWRLIFFINVPIGILGIYLT
NKHIANTREPHPGPLDWIGFFLSAAGAVLLLLGLSLIGGELIANRDAFGMCGVGAVLLVL
YVVYAQRARLPLLDLRFFKVPTFQASVLGGSLFRIGLGALPFLLPLMLQEGHGMSAFQSG
LITCASAFGGMFMRTVASRVLHRYGFRSVLVVNAALSGVSIAACGLFFPGTPTWIIWVVV
LLGGFFPALQFTSLNSLTYAEIASRDVGRATSLGSVVQQMSLGLGVTVGGIVLQISRMLN
GHDAIMWSDFWPAFLVVGLCSFASIPVTLRLPRGAGEEISRGGRG