Protein Info for ABIE53_002249 in Paraburkholderia graminis OAS925

Annotation: small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 151 to 216 (66 residues), 65.6 bits, see alignment E=3.4e-22

Best Hits

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>ABIE53_002249 small-conductance mechanosensitive channel (Paraburkholderia graminis OAS925)
MPTLTDGVLYGLGILVLDFLAWRFMGRRSEQARLALRALMFGLSSYVLFSHGMNPLREAP
WSAEPVRHLLAQILEVVWWLQGARLVTVVLDRMVLPDTWHKERLFQDVLGALVFLAAAVG
AIAFVLQLPVRGLLATSGAVAVVLGLAIQSTLNDVFSGIVLNATQPFRIGDWITIGEVEG
RVVESNWRATSLLNSQGNIVVIPNSVAARTNIVNANQPMHTHGVSVVLPVKPSVRPATVL
QALMHAAASSPEVLAEPKPLVSVKRATNDAIEYEIVCYVDAWTKKIGVRNDLYDLAHRHL
LSRGVVLRPLSVAEPIGEPADEKQRLLRNVLIFQTLDDGEIAELAAQLTPHEFDAGDTIY
SAADEGGHELHILARGVAKAGRDERGRRGRVAQARARRLGRPVRNTRRCQNRRDRARTDA
GHGVPARQGRADTDPRAAAGRGARNVPAAFRPSRKRKDAARAVRECRCGQRRFAAMDSRR
RAAFSRTRAVSAGVRVNVRLRLFPLQAF