Protein Info for ABIE53_002209 in Paraburkholderia graminis OAS925

Annotation: putative Mg2+ transporter-C (MgtC) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details PF02308: MgtC" amino acids 36 to 158 (123 residues), 123.8 bits, see alignment E=2.6e-40

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 90% identity to bgf:BC1003_1698)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>ABIE53_002209 putative Mg2+ transporter-C (MgtC) family protein (Paraburkholderia graminis OAS925)
MNSGSQTVWETVWQTAKGEFSDLGSAADLTQVLMRLGIALVLGGVIGFEREISRRDAGMR
THMMVAVGAALFVVVPLHAGFSQDNMSRVLQGLVSGIGFLGAGAVIKLSAQREVRGLTTA
ASLWLSAGVGMAAGLGREATAILSVVIALLILSSARLVKGRSHPRK