Protein Info for ABIE53_002124 in Paraburkholderia graminis OAS925

Annotation: putative MFS family arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 355 (333 residues), 122.9 bits, see alignment E=7.4e-40

Best Hits

Swiss-Prot: 39% identical to NEPI_SHIDS: Purine ribonucleoside efflux pump NepI (nepI) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: None (inferred from 77% identity to bph:Bphy_6830)

Predicted SEED Role

"transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>ABIE53_002124 putative MFS family arabinose efflux permease (Paraburkholderia graminis OAS925)
MSTVSNQSAISRRQVWSAVASMAMCAAMLIASEFMPVSLLTPIASDLRASVGMAGQAISI
SGLFAVATSLIIPSVTSRLDRRHVLAGLAGLMLMSLVLIAEARSFEMLMAARALLGVTVG
GFWSLATATIMRLVPEESVPKALGVLYTGNAVATSFAAPIGSYLGSVIGWRGVFWALVPI
VAINLVMLLVTLPPMKTRASQDGGANALALLRRPHVSFAMLAVMLTFAGAFEVFTYFRPF
FETYTHVGVPRLPVLLLGMGLAGFAGTYGASALIGKRLFHLLMALPVALAVVTLIMLPAG
HSFGAAALLAIAWGAVNAAIPVAWSTWLSKGVKDKPESGGGLMVASIQLSIMVGAELGGT
LLDHYSIGATFLSGAALLVLSAIVVGSGRRLRPAV