Protein Info for ABIE53_002016 in Paraburkholderia graminis OAS925

Annotation: undecaprenyl phosphate-alpha-L-ara4FN deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF01522: Polysacc_deac_1" amino acids 15 to 155 (141 residues), 25.8 bits, see alignment E=4.3e-10

Best Hits

Swiss-Prot: 37% identical to ARND_PHOLL: Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (arnD) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: None (inferred from 95% identity to bug:BC1001_1840)

Predicted SEED Role

"Polymyxin resistance protein PmrJ, predicted deacetylase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABIE53_002016 undecaprenyl phosphate-alpha-L-ara4FN deformylase (Paraburkholderia graminis OAS925)
MARIVLKIDVDTLRGTREGVPNLARIFDRFKARATFLFSLGPDHTGWAMRRVLRPGFLKK
VSRTSVVEHYGIRQLMYGVLLPGPDIGVKASAEMRAIHEAGFECGIHTWDHVYWQDNVRS
KDRGWTAAQMQQSHDRFVDIFGAPPLTHGAAGWQMNGHAFEQIDAWGMHYASDGRGHSPY
LPVVDGKTLAHVQMPTTLPTLDEVLGVNGVDEHNVAAFMLKHTENNPHDQVFTLHAELEG
QKLAPILEQLLNGWRAQGHTFATMGDYYAALDRGALPSYPVTWGEIPGRSGELIVQP