Protein Info for ABIE53_001984 in Paraburkholderia graminis OAS925

Annotation: lipooligosaccharide transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 44 to 70 (27 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 132 to 133 (2 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details TIGR01291: ABC-2 type transporter, NodJ family" amino acids 23 to 274 (252 residues), 331.5 bits, see alignment E=1.8e-103 PF01061: ABC2_membrane" amino acids 29 to 239 (211 residues), 85.5 bits, see alignment E=3.8e-28 PF12698: ABC2_membrane_3" amino acids 77 to 266 (190 residues), 36 bits, see alignment E=4.4e-13

Best Hits

Swiss-Prot: 64% identical to NODJ_RHIME: Nodulation protein J (nodJ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09694, lipooligosaccharide transport system permease protein (inferred from 95% identity to bgf:BC1003_1482)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>ABIE53_001984 lipooligosaccharide transport system permease protein (Paraburkholderia graminis OAS925)
MDARTYRSNEARPPSQALLAALPANAVNWIAVWRRNYLVWKKLALASMFGNLADPMIYLF
GLGFGLGLMVGRVDGVSYIAFLAAGTVASSVMMSASFESMYSGFSRMHVQRTWEAIMHTP
LTLGDIVLGEVIWAASKSVLSGVAIMLVAGALGYASFPSMLLALPVIVLTGLAFASVAMV
VTALAPSYDFFMFYQTLVLTPMLLLSGVFFPISQLPAAARGAAQVLPLAHAVDLLRPAML
ARPLDNALSHVVVLTVYAVGGFVVSAVLFRRRMMK