Protein Info for ABIE53_001909 in Paraburkholderia graminis OAS925

Annotation: putative MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 278 (250 residues), 95.7 bits, see alignment E=4e-31 amino acids 273 to 443 (171 residues), 39 bits, see alignment E=7.2e-14 PF12832: MFS_1_like" amino acids 47 to 398 (352 residues), 36.1 bits, see alignment E=6.3e-13 PF00083: Sugar_tr" amino acids 48 to 440 (393 residues), 188.8 bits, see alignment E=2.7e-59

Best Hits

KEGG orthology group: K08368, MFS transporter, putative metabolite transport protein (inferred from 93% identity to bge:BC1002_5788)

Predicted SEED Role

"Sugar transporter, MFS superfamily protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>ABIE53_001909 putative MFS transporter (Paraburkholderia graminis OAS925)
MAKTLVGIEDLPTSRFHRRIAVVAAGGPFCDGYLLGIIVVALPFIAKDLALSALQIGLIG
ASSLIGMFAGGVVFGPMTDRFGRQKMYVLNLAVFVICSLAHLFVHDVTTLFILRFIMGVA
LGADYPIATALAAEFLPRKLRGPVLASLVLLLWVGYTLSLATGLIVSGSESGVWRYILAS
AAIPSALFLLLRLNIPESPRWLISVGRVEAARGIVEQHLGPQVDFDALVAETRVSTSRRG
LGLSKIRELISRGYGRMLVFCSIFWMCQIAPSFAIKTFQPMLLKSLGVTRPLAGSLVIIS
FAIVGTAIGMFVVNRVGRRTLCLASFVLATLALFLLATPMSGIATVAIGLFILFTVAEAA
GSGLQFIYPNEIFPTDLRATGMGLAMSASRIGAAAGTFLLPTVLVHFGSATGLLIAGGIS
LVGLLVSARMAPETRHVSLGAANAPTVDASAGEHALQRREARS